PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00438.1.g00300.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family WRKY
Protein Properties Length: 559aa    MW: 61235.8 Da    PI: 8.422
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00438.1.g00300.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.49.4e-31341397258
                                   --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
                          WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                                   +Dgy+WrKYGqK++k+s++prsYYrCt ++C++kk+ver+ ++p+++ +tYeg H h
  Zpz_sc00438.1.g00300.1.am.mk 341 EDGYKWRKYGQKSIKNSPNPRSYYRCTNPRCNAKKQVERAMDEPDTLLVTYEGLHLH 397
                                   8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081126.383335400IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.7E-28336398IPR003657WRKY domain
SuperFamilySSF1182901.7E-25338398IPR003657WRKY domain
SMARTSM007747.1E-35340399IPR003657WRKY domain
PfamPF031061.8E-24341397IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
MATHPAGAGA GAGAGGISID QKWKIDGRVG FDQSMVAAEL IERRKEEELR KYSFVCTHCK  60
HWSTPCTPEN LKMTTTMMID EQVPSSCWIS ARDSLNPMVR STRLNSEYAP SVFFLPALRS  120
SRAVERKGNS TSGPGIRECK LIHGDTKTAQ ATRRIWSKTE SARIHALHYS IHSTNESGRE  180
RVDPAELQLQ APIHSSAGMP AIYPIARPAR LRMDGWMDSL NQHLRRTAPC CAIHAFRPRM  240
QQISVLDRDR PITHVDHDEE TEGPRRRRET SMVNKLISTV YSGPTISDIE SALSFTGGAG  300
DHQLAVKYGS SPVVFSPEKV LSKMENKYTL KIKTCGNGLA EDGYKWRKYG QKSIKNSPNP  360
RSYYRCTNPR CNAKKQVERA MDEPDTLLVT YEGLHLHYTY SHFLHSAQVQ HQQGLPKKPK  420
RGPANSSSLL LSSDHDEVLD TNTAPAASNG GGAGDAAVLP GVSVSEAAAS AAWSCFDGGD  480
EEQQQHHHHM EAHMANKNGG LLEDVVPLLV RRPCGSTATT TTGTGGSSQD NSPPSPSASS  540
VPWTPTSPYI DMAILSNIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A5e-193393971674Probable WRKY transcription factor 4
1wj2_A5e-193393971674Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0332402e-94BT033240.1 Zea mays full-length cDNA clone ZM_BFb0071M13 mRNA, complete cds.
GenBankBT0624332e-94BT062433.1 Zea mays full-length cDNA clone ZM_BFb0296J15 mRNA, complete cds.
GenBankKJ7275732e-94KJ727573.1 Zea mays clone pUT5433 WRKY transcription factor (WRKY120) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001130113.13e-90putative WRKY DNA-binding domain superfamily protein
TrEMBLB4F8023e-90B4F802_MAIZE; Uncharacterized protein
STRINGAC165171.2_FGP0029e-90(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75253551
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.12e-43WRKY DNA-binding protein 49